O14668 TMG1_HUMAN

Gene name: PRRG1
Protein name: Transmembrane gamma-carboxyglutamic acid protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BW72 HIGD2A 0.55964 cell death GO:0008219
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q9H222 ABCG5 0.48624 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
3 Q6NXG1 ESRP1 0.4839 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
4 O00712 NFIB 0.47688 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 P35555 FBN1 0.46829 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell adhesion GO:0007155
...
6 Q9NYA1 SPHK1 0.46829 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q5JST6 EFHC2 0.46801 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 O14543 SOCS3 0.46726 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 P17405 SMPD1 0.46668 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 P27986 PIK3R1 0.46436 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFL
STMI:                                                                                                       MMMMMMMMMMMMMMMMM
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             .............................................................DD.....................................
DO_SPOTD:                D...................................................................................................
CONSENSUS:               ...................................................................................                 
CONSENSUS_MOBI:          ...................................................................................                 

                                          120                 140                 160                 180                 200
AA:                      IWRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV
STMI:                    MMMMMM                                                                                              
DO_DISOPRED3:            ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
DO_IUPRED2A:             ................D......DDDDD..D.D..DD..D......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
CONSENSUS:                     ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS_MOBI:                ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
RICH_[I]:                                   IpfpqhlnII                                                                       
RICH_[P]:                                    PfPqhlniitPPPPP                                                                 
RICH_[S]:                                                        SSglSpgflgyvvgrSdSvS                                        
RICH_[GS]:                                                       SSGlSpGflGyvvGrSdSvS                                        
RICH_[HI]:                                 HIpfpqHlnII                                                                       
RICH_[HP]:                                 HiPfPqHlniitPPP                                                                   
RICH_[IP]:                                  IPfPqhlnIItPPPPP                                                                 
RICH_fLPS_[P]:                               PfPqhlniitPPPPP                                                                 

                           
AA:                      NSNSASAIPMVPVVTTIK
STMI:                                      
DO_DISOPRED3:            ..DDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDD.......D.......
DO_SPOTD:                .DDDDDDDDDDDDDDDDD
CONSENSUS:               .DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................
RICH_[IV]:                      IpmVpVVttI