Q9BW72 HIG2A_HUMAN
Gene name: HIGD2A
Protein name: HIG1 domain family member 2A, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P27986 | PIK3R1 | 0.7398 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 2 | P17405 | SMPD1 | 0.73735 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | O14543 | SOCS3 | 0.73609 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 4 | Q9NYA1 | SPHK1 | 0.729 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q5JST6 | EFHC2 | 0.72406 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q6NXG1 | ESRP1 | 0.69162 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q969L2 | MAL2 | 0.68599 | anatomical structure development GO:0048856 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | Q0P6H9 | TMEM62 | 0.6562 | |
| 9 | Q9NVV9 | THAP1 | 0.63333 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 10 | P36941 | LTBR | 0.62275 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 ... |
20 40 60 80 100 AA: MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVT STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.....D........................................................................ DO_IUPRED2A: .......DDD..D..........D..........DDD..D............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................. ............... CONSENSUS_MOBI: .............................................. ............... RICH_[PV]: PViPeVPfePskPPV RICH_[P]: PgPviPevPfePskPPvieglsP RICH_[IP]: IPevPfePskPPvI RICH_[IV]: VIpeVpfepskppVI RICH_fLPS_[P]: PgPviPevPfePskPP
AA: AMKSRP STMI: MMM DO_DISOPRED3: .....D DO_IUPRED2A: ...... DO_SPOTD: ..DDDD CONSENSUS: ..D CONSENSUS_MOBI: ...