O14737 PDCD5_HUMAN

Gene name: PDCD5
Protein name: Programmed cell death protein 5

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cell population proliferation GO:0008283
- membrane organization GO:0061024
- protein folding GO:0006457
- protein targeting GO:0006605
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P60608 ERVFC1-1 0.93682
2 A6NHC0 CAPN8 0.7665
3 Q8NB16 MLKL 0.75699 cell death GO:0008219
cellular component assembly GO:0022607
immune system process GO:0002376
...
4 Q01524 DEFA6 0.75503 immune system process GO:0002376
response to stress GO:0006950
5 Q9BX46 RBM24 0.72906 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 Q14994 NR1I3 0.69191 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9Y6H3 ATP23 0.68851 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
8 Q9H1L0 MIR1-1HG 0.6627
9 Q9UI12 ATP6V1H 0.6627 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
homeostatic process GO:0042592
...
10 Q9Y615 ACTL7A 0.65496

                                           20                  40                  60                  80                 100
AA:                      MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVS
STMI:                                                                                                                        
DO_DISOPRED3:            DD...............D.DDDDDDDDDDDDDDDDDD...............................................................
DO_IUPRED2A:             .DD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............D......................................D..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS:               DDD........DDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AQ]:                          QrlAelQAkhgdpgdAAQQ                                                                      
RICH_[Q]:                           QrlaelQakhgdpgdaaQQ                                                                      

                                          120               
AA:                      QQTEKTTTVKFNRRKVMDSDEDDDY
STMI:                                             
DO_DISOPRED3:            ..............DDDDDDDDDDD
DO_IUPRED2A:             ...D.DDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ..............DDDDDDDDDDD
CONSENSUS:               ..............DDDDDDDDDDD
CONSENSUS_MOBI:          .........................
RICH_fLPS_[D]:                         kvmDsDeDDD