Q9Y6H3 ATP23_HUMAN
Gene name: ATP23
Protein name: Mitochondrial inner membrane protease ATP23 homolog
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- protein maturation GO:0051604
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q3MHD2 | LSM12 | 0.98925 | |
| 2 | Q96SR6 | ZNF382 | 0.87374 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q96SA4 | SERINC2 | 0.87146 | |
| 4 | Q9Y3C7 | MED31 | 0.87115 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 5 | Q9NVH2 | INTS7 | 0.81982 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | O60437 | PPL | 0.7765 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | P60608 | ERVFC1-1 | 0.73288 | |
| 8 | O94886 | TMEM63A | 0.71281 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | A8MTZ0 | BBIP1 | 0.70942 | cellular component assembly GO:0022607 protein transport GO:0015031 transport GO:0006810 |
| 10 | P0C7V9 | METTL15P1 | 0.70536 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
20 40 60 80 100 AA: MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDD.......................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AQ]: AgApderrrgpAAgeQlQQQ RICH_[Q]: QlQQQhvscQvfperlaQgnpQQ RICH_fLPS_[Q]: paageQlQQQhvscQvfperlaQgnpQQ
120 140 160 180 200 AA: ASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: AKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI STMI: DO_DISOPRED3: ............................................DD DO_IUPRED2A: .............................................. DO_SPOTD: ........................................DDDDDD CONSENSUS: ............................................DD CONSENSUS_MOBI: ..............................................