Q01524 DEF6_HUMAN
Gene name: DEFA6
Protein name: Defensin-6
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BX46 | RBM24 | 0.84911 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | A6NHC0 | CAPN8 | 0.81799 | |
| 3 | Q9H936 | SLC25A22 | 0.81726 | generation of precursor metabolites and energy GO:0006091 transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | P60608 | ERVFC1-1 | 0.80698 | |
| 5 | O14737 | PDCD5 | 0.75503 | cell death GO:0008219 cell population proliferation GO:0008283 membrane organization GO:0061024 ... |
| 6 | Q9Y6X3 | MAU2 | 0.75454 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 7 | Q8NB16 | MLKL | 0.74951 | cell death GO:0008219 cellular component assembly GO:0022607 immune system process GO:0002376 ... |
| 8 | Q9H0Z9 | RBM38 | 0.67037 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 9 | Q8N9H6 | C8orf31 | 0.67002 | |
| 10 | Q9UQB9 | AURKC | 0.63172 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
20 40 60 80 AA: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL STMI: SSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... DO_IUPRED2A: .............................DD.DDDDDD.............................................................. DO_SPOTD: ..................DDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: ................................................................................. RICH_[AD]: AeDDplqAkAyeADA RICH_[AQ]: QAeddplQAkAyeAdAQeQrgA RICH_[A]: AeddplqAkAyeAdA RICH_[Q]: QaeddplQakayeadaQeQ