O14931 NCTR3_HUMAN
Gene name: NCR3
Protein name: Natural cytotoxicity triggering receptor 3
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7Z449 | CYP2U1 | 0.99699 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 2 | Q9NVV9 | THAP1 | 0.92126 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 3 | Q06495 | SLC34A1 | 0.88876 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | O14543 | SOCS3 | 0.83607 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 5 | P17405 | SMPD1 | 0.836 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q00973 | B4GALNT1 | 0.83587 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P27986 | PIK3R1 | 0.83457 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | Q8N5S1 | SLC25A41 | 0.83405 | |
| 9 | Q9NYA1 | SPHK1 | 0.83405 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | Q5JST6 | EFHC2 | 0.83155 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRG STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: .................................................................................. CONSENSUS_MOBI: ..................................................................................
120 140 160 180 200 AA: HDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPG STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................................................D.......DDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................DD..................................................DD.............D..... DO_SPOTD: ......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................................... ..................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................DDDDD ............................................ RICH_[P]: PavvPaPlPPPcgssahllPPvP RICH_[LP]: LPavvPaPLPPPcgssahLL RICH_fLPS_[P]: vPaPlPPPcgssahllPPvP
AA: G STMI: DO_DISOPRED3: D DO_IUPRED2A: . DO_SPOTD: D CONSENSUS: D CONSENSUS_MOBI: .