Q9NVV9 THAP1_HUMAN
Gene name: THAP1
Protein name: THAP domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7Z449 | CYP2U1 | 0.92508 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 2 | O14931 | NCR3 | 0.92126 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | Q5JST6 | EFHC2 | 0.87492 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 4 | Q96HD1 | CRELD1 | 0.87436 | anatomical structure development GO:0048856 |
| 5 | Q9NYA1 | SPHK1 | 0.87436 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | O14543 | SOCS3 | 0.87035 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | P17405 | SMPD1 | 0.86875 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | P27986 | PIK3R1 | 0.86298 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 9 | Q969L2 | MAL2 | 0.86181 | anatomical structure development GO:0048856 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | Q06495 | SLC34A1 | 0.82227 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQL STMI: DO_DISOPRED3: D..............................................................................................DDDDD DO_IUPRED2A: ...........................................................................................DDDDDDDDD DO_SPOTD: ....................................................................................DDDDDDDDDDDDDDDD CONSENSUS: ...........................................................................................DDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[PQ]: QeQl RICH_[P]: Pqeql RICH_[LP]: LLePqeqL RICH_fLPS_[P]: lePqeql
120 140 160 180 200 AA: PPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: DDDDDDDDD.DD...D...........................DDD.DDDDD..........DDDDDDDDDD........DD.................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDD................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[PQ]: PPPPlPPPvsQ RICH_[P]: PPPPlPPPvsqvdaaigllmPP RICH_[LP]: PPPPLPPP RICH_fLPS_[P]: PPPPlPPPvsqvdaaigllmPP
AA: LPNDYFEIVEVPA STMI: DO_DISOPRED3: ............. DO_IUPRED2A: ............. DO_SPOTD: ...........DD CONSENSUS: ............. CONSENSUS_MOBI: .............