O15130 NPFF_HUMAN

Gene name: NPFF
Protein name: Pro-FMRFamide-related neuropeptide FF

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell-cell signaling GO:0007267
- circulatory system process GO:0003013
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q32P28 P3H1 0.88335 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
2 Q96FL8 SLC47A1 0.86086 transmembrane transport GO:0055085
transport GO:0006810
3 Q9BXA7 TSSK1B 0.77126 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
4 Q8NFK1 GJC3 0.76275 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
nervous system process GO:0050877
5 Q9H9Q2 COPS7B 0.76104 biological process involved in symbiotic interaction GO:0044403
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
6 Q9BZA5 TXLNGY 0.7591
7 Q92637 FCGR1B 0.74736 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
8 Q9Y3D9 MRPS23 0.74305 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
9 Q8NA66 CNBD1 0.73967
10 P12314 FCGR1A 0.73296 cellular protein modification process GO:0006464
immune system process GO:0002376
membrane organization GO:0061024
...

                                           20                  40                  60                  80                 100
AA:                      MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQ
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DD.............D.........DDDDDDDDDDDDDDDDDD.........................................................
DO_IUPRED2A:             ......................DDDDDDDDDDDDDDDDDDDDDDDDDDD..DD................DDDD........DDDDDDDDD..........
DO_SPOTD:                DDDD...DDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                   ..DDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDD..........
CONSENSUS_MOBI:                              .DDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................
RICH_[Q]:                                          QQedQlsaeedseplppQdaQ                                                     
RICH_[EP]:                                      PggqqEdqlsaEEdsEPlPP                                                         
RICH_[EQ]:                                         QQEdQlsaEEdsEplppQdaQ                                                     
RICH_MOBI_[Q]:                                     QQedQlsaeedseplppQdaQ                                                     
RICH_MOBI_[EQ]:                                    QQEdQlsaEEdsEplppQdaQ                                                     

                                
AA:                      FWSLAAPQRFGKK
STMI:                                 
DO_DISOPRED3:            ...........DD
DO_IUPRED2A:             .............
DO_SPOTD:                D..DDDDDDDDDD
CONSENSUS:               ...........DD
CONSENSUS_MOBI:          .............