Q9Y3D9 RT23_HUMAN

Gene name: MRPS23
Protein name: 28S ribosomal protein S23, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15130 NPFF 0.74305 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
circulatory system process GO:0003013
...
2 Q9H9Q2 COPS7B 0.70112 biological process involved in symbiotic interaction GO:0044403
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 Q8NFK1 GJC3 0.70096 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
nervous system process GO:0050877
4 Q92637 FCGR1B 0.68233 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
5 Q8NA66 CNBD1 0.67985
6 P12314 FCGR1A 0.67341 cellular protein modification process GO:0006464
immune system process GO:0002376
membrane organization GO:0061024
...
7 Q32P28 P3H1 0.65392 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
8 A6NLW8 DUXA 0.64789 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 P62258 YWHAE 0.63541 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
10 Q8N8N0 RNF152 0.63495 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSVYGSGQRAFDLFNPNFKSTCQRFV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD...............................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDD..........................................D.DDDDD............................................
CONSENSUS:               DDDDD...............................................................................................
CONSENSUS_MOBI:          D...................................................................................................

                                          120                 140                 160                 180          
AA:                      EKYTELQKLGETDEEKLFVETGKALLAEGVILRRVGEARTQHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP
STMI:                                                                                                              
DO_DISOPRED3:            ......................................DDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .....................................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[H]:                                                         HggsHvsrkseH                                     
RICH_[Q]:                                                                          QtaleenetQkevpQdQ               
RICH_[EQ]:                                                                         QtalEEnEtQkEvpQdQhlE            
RICH_MOBI_[RV]:                                       VilRRVgeaR                                                   
RICH_MOBI_[H]:                                                    HggsHvsrkseH                                     
RICH_MOBI_[Q]:                                                                     QtaleenetQkevpQdQ               
RICH_MOBI_[R]:                                           RRvgeaRtqhggshvsR                                         
RICH_MOBI_[EQ]:                                                                    QtalEEnEtQkEvpQdQhlE