Q9BZA5 TXNG2_HUMAN

Gene name: TXLNGY
Protein name: Putative gamma-taxilin 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UIM3 FKBPL 0.78914 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
2 Q8WW22 DNAJA4 0.77612 cellular component assembly GO:0022607
protein folding GO:0006457
response to stress GO:0006950
3 Q99062 CSF3R 0.7696 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 Q8N8N0 RNF152 0.76866 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...
5 O15130 NPFF 0.7591 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
circulatory system process GO:0003013
...
6 Q53RY4 KRTCAP3 0.75575
7 Q86W25 NLRP13 0.68982
8 Q9BXA7 TSSK1B 0.65009 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
9 P32455 GBP1 0.64792 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
10 O95866 MPIG6B 0.63952 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLGKEVLL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD....D................DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
DO_IUPRED2A:             ...................DD......DDD....DDDDD...DDD...............DDDD..DDDDDDDDDDDDDDDDDDDDDD............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
CONSENSUS:               DDDDD....D.........DD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS_MOBI:          ....................................................................................................
RICH_[E]:                                                                                EsrrElpEqE                          
RICH_[Q]:                                                                               QesrrelpeQevappsgQQ                  
RICH_[EP]:                                                                         PvhctqEsrrElPEqEvaPP                      
RICH_[EQ]:                                                                              QEsrrElpEQEvappsgQQ                  

                                          120         
AA:                      LMQALNTLSTPEEKLAALCKKYADLGNSPLL
STMI:                                                   
DO_DISOPRED3:            ...............................
DO_IUPRED2A:             ...............................
DO_SPOTD:                ...........................DDDD
CONSENSUS:               ...............................
CONSENSUS_MOBI:          ...............................