O15444 CCL25_HUMAN

Gene name: CCL25
Protein name: C-C motif chemokine 25

List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6YP21 KYAT3 0.81067 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
2 Q8TBY0 RBM46 0.78279 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
3 Q7Z7C7 STRA8 0.78276 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 P15907 ST6GAL1 0.78048 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
5 Q9NRW7 VPS45 0.76868 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
6 Q86WI1 PKHD1L1 0.76868 immune system process GO:0002376
7 Q15118 PDK1 0.76868 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
8 Q8N961 ABTB2 0.76846
9 P31358 CD52 0.75491 homeostatic process GO:0042592
10 O15520 FGF10 0.75277 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSS                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD.DD...........................................................................DDDD
DO_IUPRED2A:             .............................................................................D......................
DO_SPOTD:                ..DDDDDDDDDDD................................................................................DDDDDDD
CONSENSUS:                                      .........................................................................DDDD
CONSENSUS_MOBI:                                 .............................................................................

                                          120                 140          
AA:                      HHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
STMI:                                                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........DDD....D.........DD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................................................
RICH_[H]:                HHntqtfqagpH                                      
RICH_[K]:                              KKlssgnsKlsssK                      
RICH_[S]:                                 SSgnSklSSSkfSnpiSSSkrnvSlliSanS  
RICH_[KS]:                             KKlSSgnSKlSSSKfSnpiS                
RICH_[NS]:                                            SNpiSSSkrN           
RICH_fLPS_[S]:                           lSSgnSklSSSkfSnpiSSS