P31358 CD52_HUMAN

Gene name: CD52
Protein name: CAMPATH-1 antigen

List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15520 FGF10 0.99995 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q13278 RIG 0.99746
3 Q9NRW7 VPS45 0.99746 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
4 Q16531 DDB1 0.99746 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
5 Q15118 PDK1 0.99746 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
6 Q8TBY0 RBM46 0.9823 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
7 Q7Z7C7 STRA8 0.9289 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 P15907 ST6GAL1 0.91869 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
9 Q8N961 ABTB2 0.85094
10 C9JLW8 MCRIP1 0.83908 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                   
AA:                      MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                     
DO_DISOPRED3:            DDDDDDDDDDD................DDDDDDDDDDDDDDD...................
DO_IUPRED2A:             .............................D...D...........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS:                                       ...DDDDDDDDDDDDDDD...................
CONSENSUS_MOBI:                                  .....................................
RICH_[S]:                                             SqtSSpSaSSniS                   
RICH_fLPS_[S]:                                      dtSqtSSpSaSSniS