P31358 CD52_HUMAN
Gene name: CD52
Protein name: CAMPATH-1 antigen
List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O15520 | FGF10 | 0.99995 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
2 | Q13278 | RIG | 0.99746 | |
3 | Q9NRW7 | VPS45 | 0.99746 |
protein transport
GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
4 | Q16531 | DDB1 | 0.99746 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
5 | Q15118 | PDK1 | 0.99746 |
biosynthetic process
GO:0009058 carbohydrate metabolic process GO:0005975 cell death GO:0008219 ... |
6 | Q8TBY0 | RBM46 | 0.9823 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
7 | Q7Z7C7 | STRA8 | 0.9289 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
8 | P15907 | ST6GAL1 | 0.91869 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
9 | Q8N961 | ABTB2 | 0.85094 | |
10 | C9JLW8 | MCRIP1 | 0.83908 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 |
20 40 60
AA: MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
STMI: SSSSSSSSSSSSSSSSSSSSSSSS
DO_DISOPRED3: DDDDDDDDDDD................DDDDDDDDDDDDDDD...................
DO_IUPRED2A: .............................D...D...........................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS: ...DDDDDDDDDDDDDDD...................
CONSENSUS_MOBI: .....................................
RICH_[S]: SqtSSpSaSSniS
RICH_fLPS_[S]: dtSqtSSpSaSSniS