O15520 FGF10_HUMAN

Gene name: FGF10
Protein name: Fibroblast growth factor 10

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- growth GO:0040007
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P31358 CD52 0.99995 homeostatic process GO:0042592
2 Q9NRW7 VPS45 0.99673 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
3 Q8TBH0 ARRDC2 0.99673 protein transport GO:0015031
transport GO:0006810
4 Q16531 DDB1 0.99673 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
5 Q8TBY0 RBM46 0.98046 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
6 Q7Z7C7 STRA8 0.92531 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
7 P15907 ST6GAL1 0.91486 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
8 Q8N961 ABTB2 0.84782
9 C9JLW8 MCRIP1 0.83504 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 Q9ULB5 CDH7 0.80702 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...

                                           20                  40                  60                  80                 100
AA:                      MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSG
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                               
DO_DISOPRED3:            D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ..................DDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
CONSENSUS:                                                    ..DDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS_MOBI:                                               ..........................DDDDD................................
RICH_[S]:                                                             SpeatnSSSSSfSSpSS                                      
RICH_fLPS_[S]:                                                     dmvSpeatnSSSSSfSSpSS                                      

                                          120                 140                 160                 180                 200
AA:                      TKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAH
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ...............................................................................DDDDDDDDDDDDDDDDDDD..
DO_SPOTD:                .........................................................................................DDDD.......
CONSENSUS:               .........................................................................................DDDD.......
CONSENSUS_MOBI:          ....................................................................................................

                                     
AA:                      FLPMVVHS
STMI:                            
DO_DISOPRED3:            .......D
DO_IUPRED2A:             ........
DO_SPOTD:                ........
CONSENSUS:               ........
CONSENSUS_MOBI:          .......D