O15467 CCL16_HUMAN
Gene name: CCL16
Protein name: C-C motif chemokine 16
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UK13 | ZNF221 | 0.56103 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | P49286 | MTNR1B | 0.56103 | anatomical structure development GO:0048856 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
| 3 | Q9BZX2 | UCK2 | 0.55184 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | O75290 | ZNF780A | 0.49642 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q6ZMC9 | SIGLEC15 | 0.49557 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton organization GO:0007010 ... |
| 6 | Q9BYG7 | MRO | 0.43449 | |
| 7 | P62280 | RPS11 | 0.41014 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | P23511 | NFYA | 0.40954 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | Q8N8J6 | ZNF615 | 0.40821 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P50591 | TNFSF10 | 0.40685 | anatomical structure development GO:0048856 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRN STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD..D.....................................................................DDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD....D.D..........DDDDDD...................................................................DDDDDDD CONSENSUS: DD........................................................................DDD CONSENSUS_MOBI: DDDDDDD.....................................................................D