P62280 RS11_HUMAN
Gene name: RPS11
Protein name: 40S ribosomal protein S11
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8NCL4 | GALNT6 | 0.99941 |
biosynthetic process
GO:0009058 cellular protein modification process GO:0006464 |
2 | Q9NWS0 | PIH1D1 | 0.99941 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
3 | Q8N8J6 | ZNF615 | 0.86289 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
4 | Q8TBP6 | SLC25A40 | 0.73106 | |
5 | Q9UK13 | ZNF221 | 0.73106 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
6 | A8MTZ0 | BBIP1 | 0.68321 |
cellular component assembly
GO:0022607 protein transport GO:0015031 transport GO:0006810 |
7 | Q9H1L0 | MIR1-1HG | 0.68232 | |
8 | Q96G30 | MRAP2 | 0.68232 |
generation of precursor metabolites and energy
GO:0006091 homeostatic process GO:0042592 signal transduction GO:0007165 |
9 | Q86YT5 | SLC13A5 | 0.68232 |
transmembrane transport
GO:0055085 transport GO:0006810 |
10 | Q96MR6 | CFAP57 | 0.65123 |
20 40 60 80 100
AA: MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYN
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: DDDDDDDDDDDD...DDDDDDDDDDDDDD.......................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
CONSENSUS_MOBI: D...................................................................................................
RICH_[Q]: QterayQkQptifQ
RICH_[IQ]: IQterayQkQptIfQ
120 140
AA: RFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF
STMI:
DO_DISOPRED3: ..............................................DDDDDDDDDDDD
DO_IUPRED2A: ..........................................................
DO_SPOTD: .................................................DDDDDDDDD
CONSENSUS: .................................................DDDDDDDDD
CONSENSUS_MOBI: ..........................................................