O15514 RPB4_HUMAN
Gene name: POLR2D
Protein name: DNA-directed RNA polymerase II subunit RPB4
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- ribonucleoprotein complex assembly GO:0022618
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IXL7 | MSRB3 | 0.9997 | response to stress GO:0006950 |
| 2 | Q4G0W2 | DUSP28 | 0.99646 | |
| 3 | Q5T6F0 | DCAF12 | 0.99305 | cellular protein modification process GO:0006464 |
| 4 | Q5BJD5 | TMEM41B | 0.88009 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 |
| 5 | Q8WWI5 | SLC44A1 | 0.86612 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9H6U8 | ALG9 | 0.84657 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | Q7Z601 | GPR142 | 0.84183 | |
| 8 | Q8NA29 | MFSD2A | 0.83556 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q6XR72 | SLC30A10 | 0.81741 | biosynthetic process GO:0009058 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 10 | Q96EL3 | MRPL53 | 0.77611 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDD.DDD.......................DD..DDDDDDDDDDDDDD............................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDD.............................DD.................................................. CONSENSUS: DDDDDDDDDDDDDDDD................................DD.................................................. CONSENSUS_MOBI: DDDDDDDDDDDDD....................................................................................... RICH_[AG]: AAGGsdprAG RICH_MOBI_[AG]: AAGGsdprAG
120 140 AA: ANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY STMI: DO_DISOPRED3: .......................................... DO_IUPRED2A: ..............DD.......................... DO_SPOTD: ......................................DDDD CONSENSUS: .......................................... CONSENSUS_MOBI: ..........................................