Q4G0W2 DUS28_HUMAN
Gene name: DUSP28
Protein name: Dual specificity phosphatase 28
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T6F0 | DCAF12 | 0.99943 | cellular protein modification process GO:0006464 |
| 2 | Q8IXL7 | MSRB3 | 0.99821 | response to stress GO:0006950 |
| 3 | O15514 | POLR2D | 0.99646 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q5BJD5 | TMEM41B | 0.87479 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 |
| 5 | Q8WWI5 | SLC44A1 | 0.85046 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9H6U8 | ALG9 | 0.81983 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | Q8NA29 | MFSD2A | 0.81532 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q7Z601 | GPR142 | 0.80704 | |
| 9 | Q6XR72 | SLC30A10 | 0.78325 | biosynthetic process GO:0009058 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 10 | Q9Y336 | SIGLEC9 | 0.74405 | cell adhesion GO:0007155 immune system process GO:0002376 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRAGGACL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDD...........................................DD.DDDDDD................................. DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS_MOBI: DDDDDDDDDDD......................................................................................... RICH_[AG]: GpAeAGrrGA RICH_MOBI_[AG]: GpAeAGrrGA
120 140 160 AA: VYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA STMI: DO_DISOPRED3: ................................................................DDDDDDDDDDDD DO_IUPRED2A: ........................................................................DDDD DO_SPOTD: .............................................................DDDDDDDDDDDDDDD CONSENSUS: ................................................................DDDDDDDDDDDD CONSENSUS_MOBI: .............................................................DDDDDDDDDDDDDDD