Q8IXL7 MSRB3_HUMAN
Gene name: MSRB3
Protein name: Methionine-R-sulfoxide reductase B3
List of terms from Generic GO subset, which this protein is a part of:
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O15514 | POLR2D | 0.9997 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q4G0W2 | DUSP28 | 0.99821 | |
| 3 | Q5T6F0 | DCAF12 | 0.99562 | cellular protein modification process GO:0006464 |
| 4 | Q5BJD5 | TMEM41B | 0.8792 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 |
| 5 | Q8WWI5 | SLC44A1 | 0.86222 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9H6U8 | ALG9 | 0.83945 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | Q7Z601 | GPR142 | 0.83237 | |
| 8 | Q8NA29 | MFSD2A | 0.83031 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q6XR72 | SLC30A10 | 0.80812 | biosynthetic process GO:0009058 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 10 | Q96EL3 | MRPL53 | 0.76053 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKF STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_IUPRED2A: DDD..................................................................DDDD........................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS: DDDDDDDD............................................................ CONSENSUS_MOBI: ....................................................................
120 140 160 180 AA: DSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL STMI: DO_DISOPRED3: ......................................................................DDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .....................................................................D...DDDDDDDDDDDDDDDDD.D DO_SPOTD: .....................................................................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_[AG]: GtAeGGsGvAspAqAdkA RICH_MOBI_[AG]: AdssGtAeGGsGvAspAqAdkA