O43680 TCF21_HUMAN

Gene name: TCF21
Protein name: Transcription factor 21

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- immune system process GO:0002376
- reproduction GO:0000003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NHU3 SGMS2 0.7314 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q9BVG4 PBDC1 0.7216
3 Q9H3H9 TCEAL2 0.68089
4 Q96MM3 ZFP42 0.64655 anatomical structure development GO:0048856
cell cycle GO:0007049
reproduction GO:0000003
5 Q15042 RAB3GAP1 0.63407 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 Q8TBB5 KLHDC4 0.6301
7 Q03468 ERCC6 0.62944 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 Q8TCD1 C18orf32 0.6162 signal transduction GO:0007165
9 Q9C093 SPEF2 0.61154 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
10 P48539 PCP4 0.6113 anatomical structure development GO:0048856
cell differentiation GO:0030154
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
DO_IUPRED2A:             DDDDDDDDDDDDD...DDDDD.D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
CONSENSUS_MOBI:          ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
RICH_[AR]:                                                                                               RnAAnAReRAR         
RICH_[D]:                       DveDlqevemlecDglkmD                                                                          
RICH_[E]:                         EdlqEvEmlE                EstEEssncE                                                       
RICH_[G]:                                                              GspqkGrGGlG                                           
RICH_[K]:                                                                  KgrgglgKrrKaptKKsplsgvsqegK                       
RICH_[N]:                                           NkefvtsNesteessNceN                                                      
RICH_[R]:                                                                                                RnaanaReRaR         
RICH_[DE]:                      DvEDlqEvEmlEcDglkmD                                                                          
RICH_[EG]:                                                  EstEEssncEnGspqkGrGG                                             
RICH_[EL]:                    LsdvEdLqEvEmLEcdgL                                                                             
RICH_[EN]:                                          NkEfvtsNEstEEssNcEN                                                      
RICH_[GK]:                                                             GspqKGrGGlGKrrKaptKKsplsG                             
RICH_[NR]:                                                                                               RNaaNaReRaR         
RICH_[NS]:                                                SNeSteeSSNceNgS                                                    
RICH_MOBI_[E]:                                              EstEEssncE                                                       
RICH_MOBI_[G]:                                                         GspqkGrGGlG                                           
RICH_MOBI_[K]:                                                             KgrgglgKrrKaptKKsplsgvsqegK                       
RICH_MOBI_[N]:                                      NkefvtsNesteessNceN                                                      
RICH_MOBI_[EG]:                                             EstEEssncEnGspqkGrGG                                             
RICH_MOBI_[EN]:                                     NkEfvtsNEstEEssNcEN                                                      
RICH_MOBI_[GK]:                                                        GspqKGrGGlGKrrKaptKKsplsG                             
RICH_MOBI_[NS]:                                           SNeSteeSSNceNgS                                                    

                                          120                 140                 160 
AA:                      RLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
STMI:                                                                                                   
DO_DISOPRED3:            ............................................................DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .........D.....................................................................
DO_SPOTD:                ...........................................................DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................................................................