P48539 PCP4_HUMAN

Gene name: PCP4
Protein name: Calmodulin regulator protein PCP4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q16881 TXNRD1 0.77011 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
2 Q96MM3 ZFP42 0.76081 anatomical structure development GO:0048856
cell cycle GO:0007049
reproduction GO:0000003
3 H3BMG3 SMKR1 0.66979
4 A6NIV6 LRRIQ4 0.66676
5 Q93077 H2AC6 0.65467 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
6 P39748 FEN1 0.65151 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
7 O00585 CCL21 0.6486 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 O95995 GAS8 0.64786 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
9 Q9H6D8 FNDC4 0.64311 response to stress GO:0006950
10 Q8TCD1 C18orf32 0.63908 signal transduction GO:0007165

                                           20                  40                  60                  
AA:                      MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
STMI:                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD....................DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................
RICH_[D]:                             DktsgenDgqkkvqeefDiD                             
RICH_[K]:                            KdKtsgendgqKK                                     
RICH_[GK]:                    GaGatnGKdKtsGendGqKK                                     
RICH_MOBI_[K]:                       KdKtsgendgqKK                                     
RICH_MOBI_[GK]:               GaGatnGKdKtsGendGqKK