Q8TCD1 CR032_HUMAN

Gene name: C18orf32
Protein name: UPF0729 protein C18orf32

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5MJ07 SPANXN5 0.82719
2 Q9UJN7 ZNF391 0.81258
3 O95057 DIRAS1 0.79289 signal transduction GO:0007165
4 Q5JX71 FAM209A 0.79195
5 Q96P63 SERPINB12 0.7873 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
6 A0A1B0GVM5 ETDC 0.78408
7 Q3ZM63 ETDA 0.78315
8 Q6ZNX1 SHLD3 0.78229 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
9 Q8TF39 ZNF483 0.78139
10 Q8WV22 NSMCE1 0.77993 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
...

                                           20                  40                  60    
AA:                      MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD
STMI:                                                                                                
DO_DISOPRED3:            .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................................................................DD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                                                      KgadmnglptKgpteicdKKK 
RICH_MOBI_[K]:                                                           KgKvnfKgadmnglptK           
RICH_MOBI_[N]:                                                          NkgkvNfkgadmN                
RICH_MOBI_[GK]:                                                          KGKvnfKGadmnGlptKG