O43716 GATC_HUMAN
Gene name: GATC
Protein name: Glutamyl-tRNA
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HA77 | CARS2 | 0.67982 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 2 | Q6ICB4 | PHETA2 | 0.63783 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q92604 | LPGAT1 | 0.56864 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 4 | Q9Y5R4 | HEMK1 | 0.55442 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
| 5 | Q7Z6Z6 | PNPLA5 | 0.47784 | catabolic process GO:0009056 homeostatic process GO:0042592 |
| 6 | Q86XS8 | RNF130 | 0.45713 | catabolic process GO:0009056 cell death GO:0008219 |
| 7 | Q15165 | PON2 | 0.45528 | catabolic process GO:0009056 response to stress GO:0006950 small molecule metabolic process GO:0044281 |
| 8 | P31371 | FGF9 | 0.45205 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | O75610 | LEFTY1 | 0.44587 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | O14638 | ENPP3 | 0.44213 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: ..................DDDDD.D........................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[L]: LvwLgLrapL RICH_[GL]: LvwLGLrapLGGrqG RICH_[GW]: WsrlvWlGlraplGGrqG RICH_[LW]: WsrLvWLgLrapL
120 AA: DELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS STMI: DO_DISOPRED3: ...........................DDDDDDDDD DO_IUPRED2A: .....................D...DDDDDD.DDDD DO_SPOTD: ...........................DDDDDDDDD CONSENSUS: ...........................DDDDDDDDD CONSENSUS_MOBI: ....................................