Q6ICB4 SESQ2_HUMAN
Gene name: PHETA2
Protein name: Sesquipedalian-2
List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HA77 | CARS2 | 0.66085 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 2 | O43716 | GATC | 0.63783 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 3 | Q9H7Z7 | PTGES2 | 0.53057 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 4 | Q6VVX0 | CYP2R1 | 0.51082 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 5 | P51843 | NR0B1 | 0.48275 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q9NS66 | GPR173 | 0.46434 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 |
| 7 | Q9Y5R4 | HEMK1 | 0.45658 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
| 8 | Q86XS8 | RNF130 | 0.4445 | catabolic process GO:0009056 cell death GO:0008219 |
| 9 | P55089 | UCN | 0.44355 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | Q96AQ8 | MCUR1 | 0.4255 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................DDDDDDDDDDDD................................................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: LAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEW STMI: DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................DDD....DDDDD.............D.............. DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: AGsrsAGwGlAew RICH_[AW]: AgsrsAgWglAeW RICH_[L]: Laew RICH_[R]: RqslalqRRsswksvasR RICH_[EG]: GlvEEaGsrsaGwGlaEw RICH_[EW]: EEagsrsagWglaEW RICH_[GL]: GwGLaew RICH_[GW]: GlveeaGsrsaGWGlaeW RICH_[LW]: WgLaeW
220 240 AA: ELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDD DO_IUPRED2A: ..........DDD...................................DD.DDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................... RICH_[AG]: elqGpA RICH_[AW]: elqgpA RICH_[L]: eLqgpasLLL RICH_[EG]: E RICH_[EW]: E RICH_[GL]: eLqGpasLLLGkG RICH_[LW]: eLqgpasLLL