O43914 TYOBP_HUMAN

Gene name: TYROBP
Protein name: TYRO protein tyrosine kinase-binding protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cytoskeleton organization GO:0007010
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P43354 NR4A2 0.56389 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 O15178 TBXT 0.55825 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q06828 FMOD 0.55245
4 P02808 STATH 0.54867
5 P56748 CLDN8 0.53909 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
6 Q6UXY8 TMC5 0.53169
7 O75177 SS18L1 0.51097 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q8TE60 ADAMTS18 0.50899 anatomical structure development GO:0048856
cell adhesion GO:0007155
response to stress GO:0006950
9 Q15038 DAZAP2 0.50277
10 Q15417 CNN3 0.50237 anatomical structure development GO:0048856
cell differentiation GO:0030154
cytoskeleton organization GO:0007010

                                           20                  40                  60                  80                 100
AA:                      MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSD
STMI:                    SSSSSSSSSSSSSSSSSSSSS                   MMMMMMMMMMMMMMMMMMMMM                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD.................................................DDDDDDDDDDDDD.DD.........DDDDDD
DO_IUPRED2A:             .............................................................................DDDDDD.DDDDDDD.........
DO_SPOTD:                DDDDDDD.............................................................DDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDD
CONSENSUS:                                    ...................                     ........DDDDDDDDDDDDDDDDDDDDD....DDDDDD
CONSENSUS_MOBI:                               ...................                     .............DDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AR]:                                                                                    RgRgAAeAAtRkqR                 
RICH_[R]:                                                                                     RgRgaaeaatRkqR                 
RICH_fLPS_[Y]:                                                                                                            rsd
RICH_MOBI_[QY]:                                                                                                    YQelQgQrsd
RICH_MOBI_[Q]:                                                                                            QritetespyQelQgQ   
RICH_MOBI_[Y]:                                                                                                     Yqelqgqrsd
RICH_fLPS_MOBI_[Y]:                                                                                                  elqgqrsd

                                
AA:                      VYSDLNTQRPYYK
STMI:                                 
DO_DISOPRED3:            DDDDDDDDDDDDD
DO_IUPRED2A:             .............
DO_SPOTD:                D.DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDD
RICH_[Y]:                 YsdlntqrpYY 
RICH_fLPS_[Y]:           vYsdlntqrpYY 
RICH_MOBI_[QY]:          vYsdlntQrpY  
RICH_MOBI_[Y]:           vYsdlntqrpYY 
RICH_fLPS_MOBI_[Y]:      vYsdlntqrpYY