P02808 STAT_HUMAN

Gene name: STATH
Protein name: Statherin

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15038 DAZAP2 0.6382
2 Q92481 TFAP2B 0.60311 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 P05549 TFAP2A 0.58896 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q15532 SS18 0.58498 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell morphogenesis GO:0000902
...
5 Q9Y6Y8 SEC23IP 0.5503 cellular component assembly GO:0022607
membrane organization GO:0061024
protein transport GO:0015031
...
6 O43914 TYROBP 0.54867 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q99439 CNN2 0.54641 cytoskeleton organization GO:0007010
immune system process GO:0002376
signal transduction GO:0007165
...
8 Q06828 FMOD 0.5253
9 Q6UXY8 TMC5 0.51065
10 Q8WV15 TMEM255B 0.50833

                                           20                  40                  60                  
AA:                      MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
STMI:                    SSSSSSSSSSSSSSSSSSS                                           
DO_DISOPRED3:            DDDDDDDDDDDD.................................DD.DDDDD.........
DO_IUPRED2A:             ..............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                  ..........................DDDDDDDD.........
CONSENSUS_MOBI:                             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[PQ]:                                                PyQPvPeQPlyPQPyQPQyQQ   
RICH_MOBI_[PY]:                                            YgYgPYqPvPeqPlYPqPYqPqYqqY  
RICH_MOBI_[QY]:                                            YgYgpYQpvpeQplYpQpYQpQYQQY  
RICH_MOBI_[RY]:                                     RRigRfgYgY                         
RICH_MOBI_[P]:                                                 PyqPvPeqPlyPqPyqP       
RICH_MOBI_[Q]:                                                   QpvpeQplypQpyQpQyQQ   
RICH_MOBI_[Y]:                                             YgYgpYqpvpeqplYpqpYqpqYqqY  
RICH_MOBI_[FG]:                                   FlrriGrFGyGyG                        
RICH_MOBI_[FY]:                                   FlrrigrFgYgYgpY                      
RICH_MOBI_[GY]:                                        GrfGYGYGpYqpvpeqplY             
RICH_fLPS_MOBI_[Q]:                                             yQpvpeQplypQpyQpQyQQ   
RICH_fLPS_MOBI_[YQ]:                                       YgYgpYQpvpeQplYpQpYQpQYQQY  
RICH_fLPS_MOBI_[Y]:                                    grfgYgYgpYqpvpeqplYpqpYqpqYqqY