O43921 EFNA2_HUMAN
Gene name: EFNA2
Protein name: Ephrin-A2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P68543 | UBXN2A | 0.53978 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 2 | Q9NRH1 | YAE1 | 0.53897 | protein maturation GO:0051604 |
| 3 | Q9Y620 | RAD54B | 0.45283 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 4 | O14793 | MSTN | 0.45085 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | Q8TDD5 | MCOLN3 | 0.4017 | anatomical structure development GO:0048856 cell differentiation GO:0030154 transmembrane transport GO:0055085 ... |
| 6 | Q9Y6P5 | SESN1 | 0.3612 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q9H8H0 | NOL11 | 0.34507 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 8 | A2RU37 | LINC02872 | 0.3378 | |
| 9 | P58005 | SESN3 | 0.33408 | catabolic process GO:0009056 homeostatic process GO:0042592 response to stress GO:0006950 ... |
| 10 | Q9BQQ7 | RTP3 | 0.33239 | membrane organization GO:0061024 nervous system process GO:0050877 protein targeting GO:0006605 ... |
20 40 60 80 100 AA: MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA STMI: SSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: .........................DD........................D................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDD...................................................................... CONSENSUS_MOBI: ............................................................................
120 140 160 180 200 AA: SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF STMI: DO_DISOPRED3: ............................................................................DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS: ............................................................................DDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS_MOBI: .................................................................................................... RICH_[CN]: NNsCsspggC
AA: LSTIPVLWTLLGS STMI: DO_DISOPRED3: DDDDDD......D DO_IUPRED2A: ............. DO_SPOTD: ...........DD CONSENSUS: ............D CONSENSUS_MOBI: .............