Q9NRH1 YAE1_HUMAN
Gene name: YAE1
Protein name: Protein YAE1 homolog
List of terms from Generic GO subset, which this protein is a part of:
- protein maturation GO:0051604
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXN8 | CLEC9A | 0.69022 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9HBK9 | AS3MT | 0.68599 | small molecule metabolic process GO:0044281 |
| 3 | P60409 | KRTAP10-7 | 0.61653 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 4 | Q96GX9 | APIP | 0.61593 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 5 | Q9H4E5 | RHOJ | 0.6074 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 6 | Q14525 | KRT33B | 0.60612 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 7 | O76011 | KRT34 | 0.58048 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 8 | P60371 | KRTAP10-6 | 0.5786 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | P60411 | KRTAP10-9 | 0.56011 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | A0A140TA62 | n/a | 0.55914 |
20 40 60 80 100 AA: MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCHLHNNNSTLI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: ....................DDD.......D..................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[D]: DkgDvfDeeaD RICH_[DG]: GpGDkGDvfD
120 140 160 180 200 AA: NKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPT STMI: DO_DISOPRED3: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......... DO_IUPRED2A: ................................................................................................DDD. DO_SPOTD: ..........................DDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.... CONSENSUS: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......... CONSENSUS_MOBI: .................................................................................................... RICH_[C]: CskshsgidCsyveCC RICH_[CN]: CeNNaefNkNCskshsgidC RICH_fLPS_[C]: fnknCskshsgidCsyveCC RICH_fLPS_[N]: ceNNaefNkN
220 AA: WILEQTASLVKQLGLSVDVLQHLKQL STMI: DO_DISOPRED3: .......................... DO_IUPRED2A: .......................... DO_SPOTD: .......................... CONSENSUS: .......................... CONSENSUS_MOBI: ..........................