Q96J86 CYYR1_HUMAN

Gene name: CYYR1
Protein name: Cysteine and tyrosine-rich protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZMJ4 IL34 0.85811 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
2 A0A1B0GUX0 ATP6V1FNB 0.83749
3 A5D8V6 VPS37C 0.83565 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
4 P04180 LCAT 0.83309 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
5 Q9NPA2 MMP25 0.8286 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
6 P02814 SMR3B 0.80668 nervous system process GO:0050877
7 Q9H6X2 ANTXR1 0.79644 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
8 Q9Y6U7 RNF215 0.78684 catabolic process GO:0009056
response to stress GO:0006950
9 P20809 IL11 0.78609 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q9NRQ2 PLSCR4 0.7814 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MDAPRLPVRPGVLLPKLVLLFVYADDCLAQCGKDCKSYCCDGTTPYCCSYYAYIGNILSGTAIAGIVFGIVFIMGVIAGIAICICMCMKNHRATRVGILR
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                MMMMMMMMMMMMMMMMMMMMM                  
DO_DISOPRED3:            DDDDDDDDDD..........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDD..........................................................................................
CONSENSUS:                                            ................................                     ..................
CONSENSUS_MOBI:                                       ................................                     ..................

                                          120                 140      
AA:                      TTHINTVSSYPGPPPYGHDHEMEYCADLPPPYSPTPQGPAQRSPPPPYPGNARK
STMI:                                                                          
DO_DISOPRED3:            ...............................DDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...................................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...............................DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PY]:                                              YsPtPqgPaqrsPPPPYP     
RICH_[P]:                                                 PtPqgPaqrsPPPPyP     
RICH_fLPS_[P]:                                          ysPtPqgPaqrsPPPPyPgn   
RICH_MOBI_[PY]:                                 YcadlPPPYsPtPqgP               
RICH_MOBI_[P]:                                       PPPysPtPqgPaqrsPPPPyP     
RICH_fLPS_MOBI_[P]:                                  PPPysPtPqgPaqrsPPPPyP