O95832 CLD1_HUMAN

Gene name: CLDN1
Protein name: Claudin-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O60830 TIMM17B 0.91267 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
2 Q99439 CNN2 0.77299 cytoskeleton organization GO:0007010
immune system process GO:0002376
signal transduction GO:0007165
...
3 Q9HBD1 RC3H2 0.72753 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
4 Q8N4L2 PIP4P2 0.71784 transport GO:0006810
vesicle-mediated transport GO:0016192
5 Q969E2 SCAMP4 0.67512 protein transport GO:0015031
transport GO:0006810
6 Q6UXY8 TMC5 0.66173
7 O14828 SCAMP3 0.6302 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
8 Q15038 DAZAP2 0.62528
9 A5D8V6 VPS37C 0.61315 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
10 Q08397 LOXL1 0.6108 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
extracellular matrix organization GO:0030198

                                           20                  40                  60                  80                 100
AA:                      MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATV
STMI:                           MMMMMMMMMMMMMMMMMMMMM                                                     MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDD....DD...........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD.................................................................................................
CONSENSUS:               DDD....                     .....................................................                   
CONSENSUS_MOBI:          .......                     .....................................................                   

                                          120                 140                 160                 180                 200
AA:                      GMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYP
STMI:                    MM             MMMMMMMMMMMMMMMMMMMMM                           MMMMMMMMMMMMMMMMMMMMM                
DO_DISOPRED3:            .........................................................................................DDDDDDDDDDD
DO_IUPRED2A:             ..............................................................................................DDDDDD
DO_SPOTD:                ........................................................................................DDDDDDDDDDDD
CONSENSUS:                 .............                     ...........................                     .....DDDDDDDDDDD
CONSENSUS_MOBI:            .............                     ...........................                     .......DDDDDDDDD
RICH_[PY]:                                                                                                           YPtPrPYP
RICH_[P]:                                                                                                             PtPrPyP
RICH_[TY]:                                                                                                        TTsYpTprpY 
RICH_MOBI_[PY]:                                                                                                      YPtPrPYP
RICH_MOBI_[P]:                                                                                                        PtPrPyP
RICH_fLPS_MOBI_[Y]:                                                                                                 sYptprpYp

                                  
AA:                      KPAPSSGKDYV
STMI:                               
DO_DISOPRED3:            DDDDDDDDDDD
DO_IUPRED2A:             ...D.......
DO_SPOTD:                DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDD
RICH_[PY]:               kPaPssgkdY 
RICH_[P]:                kPaP       
RICH_MOBI_[PY]:          kPaPssgkdY 
RICH_MOBI_[P]:           kPaP       
RICH_fLPS_MOBI_[Y]:      kpapssgkdYv