O60869 EDF1_HUMAN

Gene name: EDF1
Protein name: Endothelial differentiation-related factor 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HAN9 NMNAT1 0.86106 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
2 Q4W5G0 TIGD2 0.85973
3 Q8WV22 NSMCE1 0.85791 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
...
4 Q6ZNX1 SHLD3 0.85677 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
5 Q3ZM63 ETDA 0.85628
6 A0A1B0GVM5 ETDC 0.85572
7 Q9H3H1 TRIT1 0.85408 cellular nitrogen compound metabolic process GO:0034641
8 A0AVF1 TTC26 0.85334 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 Q96P63 SERPINB12 0.85334 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
10 Q5JX71 FAM209A 0.84824

                                           20                  40                  60                  80                 100
AA:                      MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKIN
STMI:                                                                                                                        
DO_DISOPRED3:            DD............DDDDDDDDDDDDD..................DDDDDDDDDDDDDD.........................................
DO_IUPRED2A:             ......DDDDDDDDDDDD.DDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDD...D.DDDDDDDDDDDDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS:               DD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS_MOBI:          ................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
RICH_[AK]:                            KKgptAAqAKsKqAilAA                                                                     
RICH_[AQ]:                                 AAQAkskQAilAAQ                                                                    
RICH_[A]:                                  AAqAkskqAilAA                                                                     
RICH_[K]:                             KKgptaaqaKsK                KKwaagqnKqhsitKntaK                                        
RICH_fLPS_[A]:                           ptAAqAkskqAilAA                                                                     
RICH_MOBI_[K]:                                                    KKwaagqnKqhsitKntaK                                        

                                          120                 140            
AA:                      EKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
STMI:                                                                    
DO_DISOPRED3:            ...........................................DDDDD
DO_IUPRED2A:             DDDD.DDDDDDDD...D........D........DDDDDDDDDDDDDD
DO_SPOTD:                ..................................DDDDDDDDDDDDDD
CONSENSUS:               ..................................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ................................................