O60888 CUTA_HUMAN

Gene name: CUTA
Protein name: Protein CutA

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P00540 MOS 0.76968 cell cycle GO:0007049
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
2 Q9H1D0 TRPV6 0.57881 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
...
3 Q9NWQ9 C14orf119 0.56477
4 Q14765 STAT4 0.55703 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
5 Q12918 KLRB1 0.55475 immune system process GO:0002376
signal transduction GO:0007165
6 Q9H0V9 LMAN2L 0.54159 protein folding GO:0006457
protein transport GO:0015031
transport GO:0006810
...
7 Q6ZRC1 C4orf50 0.53212
8 Q5TGS1 HES3 0.52363 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 A0A1B0GTW7 LMLN2 0.52242 cell adhesion GO:0007155
10 Q5SZK8 FREM2 0.5149 anatomical structure development GO:0048856
cell adhesion GO:0007155
embryo development GO:0009790

                                           20                  40                  60                  80                 100
AA:                      MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLI
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
DO_IUPRED2A:             ...............................................DDDDDDDDDDDDDD.......................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
CONSENSUS:                                               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
CONSENSUS_MOBI:                                          DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
RICH_[PS]:                                                            SgSPPtqPSPaSdSgS                                       
RICH_[S]:                                                             SgSpptqpSpaSdSgS                                       
RICH_[LP]:                                                LLLLPrvLLtmasgsPPtqPsP                                             
RICH_fLPS_[L]:                                           rLLLLprvLLtmasg                                                     
RICH_fLPS_MOBI_[L]:                                      rLLLLprvLLtmasgspptq                                                

                                          120                 140                 160 
AA:                      PQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
STMI:                                                                                                   
DO_DISOPRED3:            ......................................................................DDDDDDDDD
DO_IUPRED2A:             ...............................................................................
DO_SPOTD:                .....................................................................DDDDDDDDDD
CONSENSUS:               ......................................................................DDDDDDDDD
CONSENSUS_MOBI:          ...............................................................................