O75409 HYPM_HUMAN

Gene name: H2AP
Protein name: Huntingtin-interacting protein M

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NYP7 ELOVL5 0.80413 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
2 P62068 USP46 0.73841 catabolic process GO:0009056
cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
...
3 Q9Y639 NPTN 0.72863 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
4 Q5FWF7 FBXO48 0.72757 catabolic process GO:0009056
5 P49768 PSEN1 0.72544 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q96GC9 VMP1 0.7046 anatomical structure development GO:0048856
catabolic process GO:0009056
cell adhesion GO:0007155
...
7 Q96BQ5 CCDC127 0.69638
8 O14718 RRH 0.69388 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165
9 Q99463 NPY6R 0.68884
10 Q9Y3Y4 PYGO1 0.68588 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAES
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD..................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[N]:                     NckNsstNNNqtqdpsrN                                                                             
RICH_[KN]:                  KKNcKNsstN                                                                                       
RICH_fLPS_[N]:           msekkNckNsstNNNqtqdpsrN                                                                             
RICH_MOBI_[N]:                NckNsstNNNqtqdpsrN                                                  NNgsmrNtsqdrerevdNN        
RICH_MOBI_[R]:                                                                                         RntsqdReRevdnnR       
RICH_MOBI_[ER]:                                                                                              REREvdnnREphsaEs
RICH_MOBI_[KN]:             KKNcKNsstN                                                                                       
RICH_MOBI_[NQ]:                      NNNQtQdpsrNelQ                                                                          
RICH_MOBI_[NR]:                                                                                   NNgsmRNtsqdReRevdNNR       
RICH_fLPS_MOBI_[N]:         kkNckNsstNNNqtqdpsrN                                                                             

                            
AA:                      DVTRFLFDEMPKSRKND
STMI:                                     
DO_DISOPRED3:            ............DDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD
DO_SPOTD:                .DDDDDDDDDDDDDDDD
CONSENSUS:               .DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDD
RICH_MOBI_[ER]:          dvtR