P49768 PSN1_HUMAN

Gene name: PSEN1
Protein name: Presenilin-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- nucleocytoplasmic transport GO:0006913
- protein maturation GO:0051604
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A2RUB1 MEIOC 0.74379 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
2 Q96GC9 VMP1 0.73274 anatomical structure development GO:0048856
catabolic process GO:0009056
cell adhesion GO:0007155
...
3 Q9NZJ9 NUDT4 0.72736 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 O75409 H2AP 0.72544 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
5 Q9NV23 OLAH 0.71884
6 A8MYZ0 MINDY4B 0.71219
7 Q8TDW0 LRRC8C 0.68733 cell differentiation GO:0030154
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...
8 O95976 IGSF6 0.68304 immune system process GO:0002376
signal transduction GO:0007165
9 Q92851 CASP10 0.6662 cell death GO:0008219
signal transduction GO:0007165
10 Q9NYP7 ELOVL5 0.66571 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI
STMI:                                                                                                      MMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_IUPRED2A:             .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........                  
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............                  
RICH_[N]:                            NaqmsedNhlsNtvrsqNdNrerqehN                                                             
RICH_[R]:                                          RsqndnReRqehndRR                                                          
RICH_[NR]:                                      NtvRsqNdNReRqehNdRR                                                          
RICH_fLPS_[N]:                       NaqmsedNhlsNtvrsqNdNrerqehN                                                             
RICH_MOBI_[QV]:                                                                 QgnsrQVVeQ                                   
RICH_MOBI_[N]:                       NaqmsedNhlsNtvrsqNdNrerqehN                                                             
RICH_MOBI_[R]:                                     RsqndnReRqehndRR                                                          
RICH_MOBI_[NR]:                                 NtvRsqNdNReRqehNdRR                                                          
RICH_fLPS_MOBI_[N]:                  NaqmsedNhlsNtvrsqNdNrerqehN                                                             

                                          120                 140                 160                 180                 200
AA:                      KSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVAL
STMI:                    MMM                             MMMMMMMMMMMMMMMMMMMMM             MMMMMMMMMMMMMMMMMMMMMMM     MMMMMM
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ............................D.......................................................................
CONSENSUS:                  .............................                     .............                       .....      
CONSENSUS_MOBI:             .............................                     .............                       .....      

                                          220                 240                 260                 280                 300
AA:                      LIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
STMI:                    MMMMMMMMMMMMMMMM    MMMMMMMMMMMMMMMMMMMMM       MMMMMMMMMMMMMMMMMMMMMMMM                            
DO_DISOPRED3:            ................................................................................................DDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ..................................................................................................DD
CONSENSUS:                               ....                     .......                        ..........................DD
CONSENSUS_MOBI:                          ....                     .......                        ............................

                                          320                 340                 360                 380                 400
AA:                      GDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
STMI:                                                                                                    MMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
DO_IUPRED2A:             .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDD...........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....                    
CONSENSUS_MOBI:          ................................................................................                    
RICH_[D]:                                         DtvaenDDggfseeweaqrD                                                       
RICH_[DE]:                                        DtvaEnDDggfsEEwEaqrD                                                       

                                          420                 440                 460             
AA:                      SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
STMI:                    M      MMMMMMMMMMMMMMMMMMMMM    MMMMMMMMMMMMMMMMMMMMM              
DO_DISOPRED3:            ...................................................................
DO_IUPRED2A:             ...................................................................
DO_SPOTD:                ...................................................................
CONSENSUS:                ......                     ....                     ..............
CONSENSUS_MOBI:           ......                     ....                     ..............