O95183 VAMP5_HUMAN

Gene name: VAMP5
Protein name: Vesicle-associated membrane protein 5

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q02363 ID2 0.90348 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
2 Q8TAG5 VSTM2A 0.90286 cell differentiation GO:0030154
cell population proliferation GO:0008283
3 P15907 ST6GAL1 0.90016 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
4 Q16445 GABRA6 0.89443 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
5 P41586 ADCYAP1R1 0.89443 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 Q9NPH3 IL1RAP 0.89004 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
7 Q7Z7C7 STRA8 0.88822 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 P59773 MINAR2 0.87416
9 P28336 NMBR 0.87179 signal transduction GO:0007165
10 Q9ULD0 OGDHL 0.86824 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSS
STMI:                                                                                            MMMMMMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            DD............................................................................................DDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD...................................................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD......................................................................                     .DDDDDD
CONSENSUS_MOBI:          ........................................................................                     ..DDDDD
RICH_[S]:                                                                                                               SSdSS

                             
AA:                      SAPRTQDAGIASGPGN
STMI:                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDD
RICH_[S]:                SaprtqdagiaS