O95633 FSTL3_HUMAN
Gene name: FSTL3
Protein name: Follistatin-related protein 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7Z5L7 | PODN | 0.95227 | cell population proliferation GO:0008283 |
| 2 | Q8NCJ5 | SPRYD3 | 0.94029 | cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 3 | Q92748 | THRSP | 0.93925 | biosynthetic process GO:0009058 transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | O95456 | PSMG1 | 0.93888 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
| 5 | Q9BVA1 | TUBB2B | 0.93655 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 6 | Q8N3F0 | MTURN | 0.93598 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q9H4B7 | TUBB1 | 0.93392 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 8 | Q9UL42 | PNMA2 | 0.93076 | cell death GO:0008219 |
| 9 | Q969Q1 | TRIM63 | 0.92721 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | A6NMX2 | EIF4E1B | 0.91529 |
20 40 60 80 100 AA: MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCD STMI: SSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDD............................................................................................. DO_IUPRED2A: D.D................................................................................................. DO_SPOTD: DDDDD............................................................................................... CONSENSUS: .......................................................................... CONSENSUS_MOBI: DDDDD.....................................................................
120 140 160 180 200 AA: GVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPC STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: PVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV STMI: DO_DISOPRED3: ................................................DDDDDDDDDDDDDDD DO_IUPRED2A: ...........................................DDDDDDDDDDDDDDDDDDDD DO_SPOTD: ............................................DDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................DDDDDDDDDDDDDDDDDDD RICH_[E]: EEppggEsaEEEE RICH_[EG]: GtpEEppGGE RICH_fLPS_[E]: tpEEppggEsaEEEE RICH_MOBI_[E]: EEppggEsaEEEE RICH_fLPS_MOBI_[E]: tpEEppggEsaEEEE