O95760 IL33_HUMAN
Gene name: IL33
Protein name: Interleukin-33
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O60488 | ACSL4 | 0.95352 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q9UGM1 | CHRNA9 | 0.93842 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 3 | P21741 | MDK | 0.93287 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q9NYL4 | FKBP11 | 0.91037 | |
| 5 | Q14588 | ZNF234 | 0.91037 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9BZA0 | TTTY10 | 0.91037 | |
| 7 | Q8N9C0 | IGSF22 | 0.91037 | |
| 8 | O14807 | MRAS | 0.91012 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 9 | Q8WW27 | APOBEC4 | 0.90805 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 10 | Q13609 | DNASE1L3 | 0.90805 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: D...................................................................DDDD............................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................DDDD............................ CONSENSUS_MOBI: .................................................................................................... RICH_[AK]: AKwKntAsKA RICH_[K]: KpKmKystnKistaKwKntasK RICH_[KN]: NKistaKwKN RICH_fLPS_[K]: KpKmKystnKistaKwKntasK
120 140 160 180 200 AA: VQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..........................................................................D......................... DO_SPOTD: DDDDDDDDDDD......................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: HSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET STMI: DO_DISOPRED3: ...................................................................... DO_IUPRED2A: ....DD................................................................ DO_SPOTD: ...................................................................... CONSENSUS: ...................................................................... CONSENSUS_MOBI: ......................................................................