P21741 MK_HUMAN

Gene name: MDK
Protein name: Midkine

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cytoskeleton organization GO:0007010
- growth GO:0040007
- immune system process GO:0002376
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IXQ5 KLHL7 0.95158 cellular protein modification process GO:0006464
2 O95760 IL33 0.93287 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 O60488 ACSL4 0.91995 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q8N2Z9 CENPS 0.86155 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
5 Q9NYL4 FKBP11 0.86155
6 O14807 MRAS 0.86132 anatomical structure development GO:0048856
cytoskeleton organization GO:0007010
signal transduction GO:0007165
7 Q8WW27 APOBEC4 0.85936 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
8 Q9HAW9 UGT1A8 0.85801 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
9 P62979 RPS27A 0.85801 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q00059 TFAM 0.85628 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGT
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD.DDDDDDDDD
CONSENSUS:                                   DDDDDDDDDDDDD...................................................................
CONSENSUS_MOBI:                              ................................................................................

                                          120                 140                 
AA:                      KVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
STMI:                                                               
DO_DISOPRED3:            .............................DDDDDDDDDDDDDD
DO_IUPRED2A:             ................................D...DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................................
RICH_[AK]:                                             KAKAKAKKgK   
RICH_[K]:                                              KaKaKaKKgKgK 
RICH_fLPS_[K]:                                         KaKaKaKKgKgK