Q9BZA0 TTY10_HUMAN
Gene name: TTTY10
Protein name: Putative transcript Y 10 protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N9C0 | IGSF22 | 1 | |
| 2 | O14807 | MRAS | 0.99973 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 3 | Q13609 | DNASE1L3 | 0.99746 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 4 | Q8WW27 | APOBEC4 | 0.99746 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 5 | Q9HAW9 | UGT1A8 | 0.99589 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 6 | P62979 | RPS27A | 0.99589 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q00059 | TFAM | 0.99388 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q14CX7 | NAA25 | 0.99388 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 9 | Q8NEL0 | CCDC54 | 0.9916 | |
| 10 | P60002 | ELOF1 | 0.98837 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
20 40 60 AA: MKLQTLMDWEEAHEKNRKNKRKAEALVAALQTCRVQDPPGTSTDCYLLPVLKPGHFKKNCPSHKKKPP STMI: DO_DISOPRED3: ..............................................................D.DDDD DO_IUPRED2A: ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........D...........DDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDD................DDDDDD............DDDDDDDDDDDDDDDD CONSENSUS: ....DDDDDDDDDDDDDD......................................DDDDDDDDDDDD CONSENSUS_MOBI: .................................................................... RICH_[K]: KKncpshKKK RICH_fLPS_[K]: KKncpshKKK