O95998 I18BP_HUMAN
Gene name: IL18BP
Protein name: Interleukin-18-binding protein
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NNB3 | IFITM5 | 0.70711 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 2 | O95755 | RAB36 | 0.6595 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 |
| 3 | P61964 | WDR5 | 0.63372 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | Q86U28 | ISCA2 | 0.62984 | cellular component assembly GO:0022607 protein maturation GO:0051604 small molecule metabolic process GO:0044281 |
| 5 | P61647 | ST8SIA6 | 0.59867 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NZN1 | IL1RAPL1 | 0.59656 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q9NZU1 | FLRT1 | 0.59537 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | P55058 | PLTP | 0.59136 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 ... |
| 9 | A8K4G0 | CD300LB | 0.57735 | immune system process GO:0002376 response to stress GO:0006950 |
| 10 | O00116 | AGPS | 0.54453 | biosynthetic process GO:0009058 protein targeting GO:0006605 protein transport GO:0015031 ... |
20 40 60 80 100 AA: MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYW STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDD...................................DDDDDDDDDDDDD............................................... DO_IUPRED2A: .....................................DDDDDDDDDD..................................................... DO_SPOTD: DDDDD.............................DDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: .......DDDDDDDDDDDDDDDD............................................... CONSENSUS_MOBI: ...................................................................... RICH_[AT]: TAATAsvrsT
120 140 160 180 AA: LGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG STMI: DO_DISOPRED3: ............................................................................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................DDDDD..........................................................DDDDDDDDDDDDDDD DO_SPOTD: ............................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................................................................................