P01138 NGF_HUMAN
Gene name: NGF
Protein name: Beta-nerve growth factor
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- nervous system process GO:0050877
- protein maturation GO:0051604
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZT3 | SLIRP | 0.76794 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9Y3D7 | PAM16 | 0.76314 | catabolic process GO:0009056 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q8N2K0 | ABHD12 | 0.74265 | catabolic process GO:0009056 cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 4 | Q9Y697 | NFS1 | 0.7331 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 5 | O75323 | NIPSNAP2 | 0.70509 | generation of precursor metabolites and energy GO:0006091 transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | P23025 | XPA | 0.67859 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | Q15526 | SURF1 | 0.65017 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 8 | Q6UXU4 | GSG1L | 0.64727 | protein transport GO:0015031 signal transduction GO:0007165 transmembrane transport GO:0055085 ... |
| 9 | Q9HCM9 | TRIM39 | 0.64542 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 10 | Q96B86 | RGMA | 0.64542 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADT STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DD........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... DO_IUPRED2A: ......................DDDDDDDDDDD.D.D.....................D............................DDDDDDD....DD DO_SPOTD: .DDDDDDDDDDDD..DDDDDDDDDD..........D...DDDDDDDDDDDDDDDDDDDDDDDDDD.................................DD CONSENSUS: ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................DD CONSENSUS_MOBI: .................................................................................. RICH_[AR]: AlRRARsApAAAiAARvA RICH_[A]: AlrrArsApAAAiAArvA RICH_[H]: HtipqaHwtklqH RICH_[R]: RRaRsapaaaiaaR RICH_[DF]: Dt RICH_fLPS_[A]: dtAlrrArsApAAAiAArvA
120 140 160 180 200 AA: QDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSY STMI: DO_DISOPRED3: ....DDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: DDD.....DDD..DDDDDDDDD.D............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .....................D.............................................................................. RICH_[RS]: RthRSkRSSS RICH_[DF]: qDlDFevggaapF
220 240 AA: CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA STMI: DO_DISOPRED3: .....................................DDDD DO_IUPRED2A: ......................................... DO_SPOTD: .....................................DDDD CONSENSUS: .....................................DDDD CONSENSUS_MOBI: .....................................DDDD