Q9Y3D7 TIM16_HUMAN

Gene name: PAM16
Protein name: Mitochondrial import inner membrane translocase subunit TIM16

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9GZT3 SLIRP 0.98363 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
2 Q96FN4 CPNE2 0.91921
3 Q9UFG5 C19orf25 0.91921
4 Q08AG7 MZT1 0.91921 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
5 P0DMW5 SMIM10L2B 0.91921
6 Q9HCM9 TRIM39 0.91899 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
7 Q96B86 RGMA 0.91899 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q9NUP9 LIN7C 0.9188 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
protein transport GO:0015031
...
9 Q9NVX2 NLE1 0.9188 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
10 Q96S52 PIGS 0.91844 biosynthetic process GO:0009058
cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVR
STMI:                                                                                                                        
DO_DISOPRED3:            D..............................DDDDDDDDDDDDDDDDD....................................................
DO_IUPRED2A:             ..................................DD..DDDDD.D.......................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
CONSENSUS:               D..............................DDDDDDDDDDDDDDDDD....................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AR]:                                              RAAAdARgRA                                                           
RICH_[A]:                                                AAAdArgrAghrsAAA                                                    
RICH_fLPS_[A]:                                          rAAAdArgrAghrsAAA                                                    

                                          120               
AA:                      AKERLDEELKIQAQEDREKGQMPHT
STMI:                                             
DO_DISOPRED3:            ..............DDDDDDDDDDD
DO_IUPRED2A:             ........DDDDDDDDDDDDDDDDD
DO_SPOTD:                ...........DDDDDDDDDDDDDD
CONSENSUS:               ...........DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................