Q9Y3D7 TIM16_HUMAN
Gene name: PAM16
Protein name: Mitochondrial import inner membrane translocase subunit TIM16
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZT3 | SLIRP | 0.98363 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q96FN4 | CPNE2 | 0.91921 | |
| 3 | Q9UFG5 | C19orf25 | 0.91921 | |
| 4 | Q08AG7 | MZT1 | 0.91921 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | P0DMW5 | SMIM10L2B | 0.91921 | |
| 6 | Q9HCM9 | TRIM39 | 0.91899 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 7 | Q96B86 | RGMA | 0.91899 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q9NUP9 | LIN7C | 0.9188 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 9 | Q9NVX2 | NLE1 | 0.9188 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 10 | Q96S52 | PIGS | 0.91844 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVR STMI: DO_DISOPRED3: D..............................DDDDDDDDDDDDDDDDD.................................................... DO_IUPRED2A: ..................................DD..DDDDD.D....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS: D..............................DDDDDDDDDDDDDDDDD.................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AR]: RAAAdARgRA RICH_[A]: AAAdArgrAghrsAAA RICH_fLPS_[A]: rAAAdArgrAghrsAAA
120 AA: AKERLDEELKIQAQEDREKGQMPHT STMI: DO_DISOPRED3: ..............DDDDDDDDDDD DO_IUPRED2A: ........DDDDDDDDDDDDDDDDD DO_SPOTD: ...........DDDDDDDDDDDDDD CONSENSUS: ...........DDDDDDDDDDDDDD CONSENSUS_MOBI: .........................