Q9GZT3 SLIRP_HUMAN

Gene name: SLIRP
Protein name: SRA stem-loop-interacting RNA-binding protein, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y3D7 PAM16 0.98363 catabolic process GO:0009056
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
2 A6NMB1 SIGLEC16 0.87442 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
3 Q6DD88 ATL3 0.8736 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
4 Q8N4F7 RNF175 0.87313 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165
5 Q7RTP0 NIPA1 0.86855 transmembrane transport GO:0055085
transport GO:0006810
6 Q9Y697 NFS1 0.86782 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
7 Q96S52 PIGS 0.86753 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
8 Q8WWT9 SLC13A3 0.86753 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
9 Q9HCM9 TRIM39 0.86532 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
10 Q69YW2 STUM 0.86532

                                           20                  40                  60                  80                 100
AA:                      MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDD..................................................................................DD
DO_IUPRED2A:             ........................................................................................DDD..DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD..............................................................................DDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD..............................................................................DDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AR]:                   AARgAAAlRR                                                                                      
RICH_[A]:                 AAsAArgAAA                                                                                         
RICH_fLPS_[A]:           mAAsAArgAAAlrrs                                                                                     

                                    
AA:                      TSDDEKKDF
STMI:                             
DO_DISOPRED3:            DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDD
DO_SPOTD:                DDDDDDDDD
CONSENSUS:               DDDDDDDDD
CONSENSUS_MOBI:          .........