P01270 PTHY_HUMAN

Gene name: PTH
Protein name: Parathyroid hormone

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- developmental maturation GO:0021700
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NYU2 UGGT1 0.8474 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
2 A8MZ26 EFCAB9 0.81603 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
3 Q7Z4B0 LINC00305 0.80345
4 Q9NP80 PNPLA8 0.7843 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
5 Q96EA4 SPDL1 0.77423 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
6 Q13061 TRDN 0.76688 circulatory system process GO:0003013
cytoskeleton organization GO:0007010
homeostatic process GO:0042592
...
7 Q14512 FGFBP1 0.75588 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
8 P19087 GNAT2 0.74003 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
9 Q9Y546 LRRC42 0.72733
10 P35520 CBS 0.70488 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGE
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................D.........................................DDDDDDDDDDDDDDDDDDDDDDD.....
DO_SPOTD:                DDDDDDDDDDDDDD.......DDD........................DDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                        .....D........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                   ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                                                                                   KKednvlvesheKslge
RICH_[V]:                                                                                                        VlVeshekslge
RICH_[EK]:                                                                                                  KKEdnvlvEshEKslgE
RICH_MOBI_[K]:                                                                                              KKednvlvesheKslge
RICH_MOBI_[V]:                                                                                                   VlVeshekslge
RICH_MOBI_[EK]:                                                                                             KKEdnvlvEshEKslgE

                              
AA:                      ADKADVNVLTKAKSQ
STMI:                                   
DO_DISOPRED3:            DDDDDDDD.....DD
DO_IUPRED2A:             .DDDD...DD.....
DO_SPOTD:                DDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDD
RICH_[K]:                adK            
RICH_[V]:                adkadVnV       
RICH_[EK]:               adK            
RICH_MOBI_[K]:           adK            
RICH_MOBI_[V]:           adkadVnV       
RICH_MOBI_[EK]:          adK