Q00LT1 PRCD_HUMAN

Gene name: PRCD
Protein name: Photoreceptor disk component PRCD

List of terms from Generic GO subset, which this protein is a part of:
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P48723 HSPA13 1 protein folding GO:0006457
response to stress GO:0006950
transport GO:0006810
...
2 Q7Z7H8 MRPL10 0.9997 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
3 Q9Y5F3 PCDHB1 0.99315 cell adhesion GO:0007155
4 P01275 GCG 0.97486 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
5 Q14953 KIR2DS5 0.94269 immune system process GO:0002376
response to stress GO:0006950
6 Q14952 KIR2DS3 0.92815 response to stress GO:0006950
7 Q96MP8 KCTD7 0.92008 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
8 Q6PGQ1 DRICH1 0.86613
9 Q7LG56 RRM2B 0.84521 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
10 B4DJY2 TMEM233 0.83674

                                           20                  40      
AA:                      MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
STMI:                    SSSSSSSSSSSSSSSSSSSS                                  
DO_DISOPRED3:            D.............................DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                   ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                              ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                            DvDgaargsslDaD            
RICH_MOBI_[D]:                                       DvDgaargsslDaD