Q16540 RM23_HUMAN

Gene name: MRPL23
Protein name: 39S ribosomal protein L23, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z3Z2 RD3 0.76309 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
2 P01286 GHRH 0.72608 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cell-cell signaling GO:0007267
...
3 Q8NBM4 UBAC2 0.71703 catabolic process GO:0009056
cell-cell signaling GO:0007267
protein transport GO:0015031
...
4 Q9UBV4 WNT16 0.70711 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
5 Q9HBV1 POPDC3 0.70711 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T292 TMEM273 0.70711
7 Q9HB89 NMUR1 0.66974 signal transduction GO:0007165
transport GO:0006810
8 P21709 EPHA1 0.66752 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q96L58 B3GALT6 0.66406 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
10 Q5T9C9 PIP5KL1 0.64782 cell death GO:0008219
cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLA
STMI:                                                                                                                        
DO_DISOPRED3:            DDD.................................................................................................
DO_IUPRED2A:             .......................................D...............................DDDDDDDDDDDDDD...............
DO_SPOTD:                DDD.......................................................................DDDDDDDDDDDD..............
CONSENSUS:               DDD.......................................................................DDDDDDDDDDD...............
CONSENSUS_MOBI:          D...................................................................................................

                                          120                 140       
AA:                      HGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
STMI:                                                                         
DO_DISOPRED3:            ......................DDDDDDD.DD.DD..D...............
DO_IUPRED2A:             .........DDDDDDD.DD.DDDDDDDDDDDDDDDDDDDDDDDDDDD......
DO_SPOTD:                ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS_MOBI:          ............DDDDDDDDDDDDD............................
RICH_[QR]:                                                RQQRQssdpRR         
RICH_[R]:                                                 RqqRqssdpRR