P01375 TNFA_HUMAN

Gene name: TNF
Protein name: Tumor necrosis factor

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- embryo development GO:0009790
- extracellular matrix organization GO:0030198
- homeostatic process GO:0042592
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nervous system process GO:0050877
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- translation GO:0006412
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q02363 ID2 0.90348 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
2 Q8TAG5 VSTM2A 0.90286 cell differentiation GO:0030154
cell population proliferation GO:0008283
3 P15907 ST6GAL1 0.90016 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
4 Q16445 GABRA6 0.89443 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
5 P41586 ADCYAP1R1 0.89443 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 Q9NPH3 IL1RAP 0.89004 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
7 Q7Z7C7 STRA8 0.88822 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 P59773 MINAR2 0.87416
9 P28336 NMBR 0.87179 signal transduction GO:0007165
10 Q9ULD0 OGDHL 0.86824 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEG
STMI:                                                       MMMMMMMMMMMMMMMMMMMMM                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDD.D.....................DDDDDDDDDDDDDDDDDDDD................
DO_IUPRED2A:             .............DDDDDDDD...........................................................D....DDDDDDDD.......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     ........DDDDDDDDDDDDDDDDDDDDDD..............
CONSENSUS_MOBI:          ...................................                     ...................DDDDDD...................
RICH_[S]:                                                                                   SliSplaqavrSSSrtpS               

                                          120                 140                 160                 180                 200
AA:                      QLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVF
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ..................................................................................DD................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220       
AA:                      QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
STMI:                                                     
DO_DISOPRED3:            .................................
DO_IUPRED2A:             .................................
DO_SPOTD:                .................................
CONSENSUS:               .................................
CONSENSUS_MOBI:          .................................