P01579 IFNG_HUMAN
Gene name: IFNG
Protein name: Interferon gamma
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96L58 | B3GALT6 | 0.93912 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 2 | Q5T9C9 | PIP5KL1 | 0.91616 | cell death GO:0008219 cellular protein modification process GO:0006464 |
| 3 | Q8N6K7 | SAMD3 | 0.90286 | |
| 4 | Q9GZY8 | MFF | 0.86513 | anatomical structure development GO:0048856 cell death GO:0008219 protein targeting GO:0006605 ... |
| 5 | Q13393 | PLD1 | 0.86193 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 6 | Q96LR9 | APOLD1 | 0.848 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 7 | P41181 | AQP2 | 0.84549 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 8 | A0A1B0GTL2 | C20orf204 | 0.84215 | |
| 9 | Q9Y2T4 | PPP2R2C | 0.83761 | cellular protein modification process GO:0006464 |
| 10 | Q13868 | EXOSC2 | 0.83205 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 growth GO:0040007 ... |
20 40 60 80 100 AA: MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDM STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............................................................................. CONSENSUS_MOBI: .............................................................................
120 140 160 AA: NVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ STMI: DO_DISOPRED3: ....................................................DDDDDDDDDDDDDD DO_IUPRED2A: ...................................................DDDDDDDDDDD.... DO_SPOTD: .............................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................................DDDDD RICH_[R]: RkRsqmlfRgRR