A0A1B0GTL2 CT204_HUMAN
Gene name: C20orf204
Protein name: Uncharacterized protein C20orf204
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3A4 | RRP7A | 0.92424 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
| 2 | P62263 | RPS14 | 0.92381 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | Q9NUL7 | DDX28 | 0.89324 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 4 | Q96CU9 | FOXRED1 | 0.8864 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 5 | P33681 | CD80 | 0.86625 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q9H0I3 | CCDC113 | 0.8578 | cellular component assembly GO:0022607 |
| 7 | O60762 | DPM1 | 0.85489 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 8 | Q9UBV4 | WNT16 | 0.84215 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 9 | Q9HBV1 | POPDC3 | 0.84215 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | Q9H2U6 | LINC00597 | 0.84215 |
20 40 60 80 100 AA: MVPPKPALWALLLALLGTAPSRAYSPACSVPDVLRHYRAIIFEDLQAAVKWGGAGAEKTRPGSRHFHFIQKNLTRPGSSGRRGRPRASCGAQKEHSILLS STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.......................................................DDDDDDDDD........... DO_IUPRED2A: ....................................................DDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDD............ DO_SPOTD: DD...................................................DDDDDDDDD...........DDDDDDDDDDDDDDDDDDDD....... CONSENSUS: ..............................DDDD....D...........DDDDDDDDDDDDDDDD........... CONSENSUS_MOBI: ............................................................................. RICH_[R]: RpgssgRRgRpR RICH_[GR]: RpGssGRRGRpR
120 140 160 180 AA: ISSLGRTLRGAVAGGRRGALERAAWTVAVRTEAVMRRHCRTLRQRSRRPKMRPARRRGGRRQLLLRALDAVATCWEKLFALRAPASRDS STMI: DO_DISOPRED3: ................................................DDDDDDDDDDDDDDD....................DDDDDD DO_IUPRED2A: .....................................DDDDDDDDDDDDDDDDDDDDDDD............................. DO_SPOTD: ..........................................DDDDDDDDDDDDDDDD.........................DDDDDD CONSENSUS: ..........................................DDDDDDDDDDDDDDDDDD.......................DDDDDD CONSENSUS_MOBI: ......................................................................................... RICH_[R]: RqRsRRpkmRpaRRRggR RICH_fLPS_[R]: RqRsRRpkmRpaRRR