P02511 CRYAB_HUMAN
Gene name: CRYAB
Protein name: Alpha-crystallin B chain
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- growth GO:0040007
- protein folding GO:0006457
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15125 | EBP | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 2 | Q9Y5K5 | UCHL5 | 0.70711 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 3 | Q695T7 | SLC6A19 | 0.5754 | transport GO:0006810 |
| 4 | Q8NI60 | COQ8A | 0.56569 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 5 | Q8N865 | C7orf31 | 0.54152 | |
| 6 | P17568 | NDUFB7 | 0.51131 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 7 | Q13018 | PLA2R1 | 0.5 | cell death GO:0008219 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 8 | Q02045 | MYL5 | 0.48766 | |
| 9 | Q9H6D3 | XKR8 | 0.48512 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 10 | Q9Y3F4 | STRAP | 0.48247 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV STMI: DO_DISOPRED3: DDD...DDDDDDDDDDDDDDDDDDDDDDDDD........................DDDDDD....................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK STMI: DO_DISOPRED3: ......DDDDDDDDDD................................DDDDDDDDD.DDDDDDDDDDDDDDDDD DO_IUPRED2A: .D......DDD...........................D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ................................................................DDDDDDDDDDD CONSENSUS: ........DDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................... RICH_[AK]: KpAvtAApKK RICH_[EI]: ErtIpItrEE