P17568 NDUB7_HUMAN

Gene name: NDUFB7
Protein name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NI60 COQ8A 0.86049 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
2 Q5VTE0 EEF1A1P5 0.81343 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q9NXB9 ELOVL2 0.79067 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
4 Q9H6D3 XKR8 0.78062 anatomical structure development GO:0048856
cell death GO:0008219
membrane organization GO:0061024
...
5 Q9BTE7 DCUN1D5 0.72848 cellular protein modification process GO:0006464
6 Q9Y5K5 UCHL5 0.7231 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
7 Q9NVR7 TBCCD1 0.70248 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
8 Q71UI9 H2AZ2 0.69397 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
9 Q9NV29 TMEM100 0.66182 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 P21741 MDK 0.65344 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMK
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             .................D.D.DDDDDDDD.DDDDDDDDDDDDDD........................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................DDD.....DDDDDDDDD
CONSENSUS:               DD...............DDDDDDDDDDDDDDDDDDDDDDD............................................................
CONSENSUS_MOBI:          DD.....................DDDDDDDDDDD..................................................................
RICH_[FP]:                                 PlqmPtFPPdygFP                                                                    

                                          120   
AA:                      EFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
STMI:                                                         
DO_DISOPRED3:            .................DDDDDDDDDDDDDDD.D..D
DO_IUPRED2A:             .......DDDD.DDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................DDDDDDDDDDDDD
RICH_[AK]:                               KKAAelAKgqgpgevdpKvA 
RICH_[K]:                           KKrreKKaaelaK